Pohjoismaiden suurin turvallisuusalan tapahtuma 26.-27.9.2017. Tapahtumassa kohtaavat alan päättäjät ja tekijät sekä yritysten turvallisuudesta vastaavat

1.67 Rating by ClearWebStats
It has a .fi as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, finnsec.fi is SAFE to browse.
Get Custom Widget

Traffic Report of Finnsec

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: WOT Trust rank for finnsec.fi Good
WOT Privacy: WOT privacy rank for finnsec.fi Good
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
33
Siteadvisor Rating
View finnsec.fi site advisor rating Not Applicable

Where is finnsec.fi server located?

Hosted IP Address:

77.86.189.241 View other site hosted with finnsec.fi

Hosted Country:

finnsec.fi hosted country FI finnsec.fi hosted country

Location Latitude:

60.1695

Location Longitude:

24.9354

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View finnsec.fi HTML resources

Homepage Links Analysis

FinnSec 26.-27.9.2017 Messukeskus Helsinki

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: 2 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 3
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 77.86.189.241)

Home - CyberSecurity Nordic

finnsec.fi favicon - cybersecuritynordic.com

View finnsec.fi Pagerank   finnsec.fi alexa rank Not Applicable   finnsec.fi website value $ 8.95

ViherTek - 12.-14.10.2016 Messukeskus, Helsinki

finnsec.fi favicon - vihertek.fi

ViherTek on ympäristösuunnittelun, -rakentamisen ja -hoidon vuoden tärkein ammattitapahtuma.

View finnsec.fi Pagerank   finnsec.fi alexa rank Not Applicable   finnsec.fi website value $ 8.95

Kiinteistö 26. - 27.9.2017 Messukeskus Helsinki

finnsec.fi favicon - kiinteistomessut.fi

Kiinteistönhoidon, isännöinnin ja kiinteistöjen peruskorjauksen vuoden tärkein tapahtuma 26.-27.9.2017 Messukeskuksessa Helsingissä.

View finnsec.fi Pagerank   finnsec.fi alexa rank Not Applicable   finnsec.fi website value $ 8.95

Hammaslääkäripäivät | Messukeskus | 24. - 26.11.2016

finnsec.fi favicon - hammaslaakaripaivatnayttely.fi

Suomen suurin hammaslääketieteen koulutustapahtuma ja näytttely. Kouluttaudu, kehity ja verkostoidu suun hoidon suurimmassa ammattitapahtumassa.

View finnsec.fi Pagerank   finnsec.fi alexa rank Not Applicable   finnsec.fi website value $ 8.95

Studia-messut | Messukeskus | 29. - 30.11.2016

finnsec.fi favicon - studiamessut.fi

Suomen suurin opiskelu- ja uratapahtuma Studia. Avoinna ti 29.11. klo 9–17, ke 30.11. klo 9–16. Tervetuloa!

View finnsec.fi Pagerank   finnsec.fi alexa rank Not Applicable   finnsec.fi website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 01 Jan 2017 09:53:09 GMT
Content-Type: text/html; charset=UTF-8
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Link: ; rel=shortlink
X-UA-Compatible: IE=Edge
X-Varnish: 9965509
Age: 0
Via: 1.1 varnish-v4
x-Cache: uncached
Transfer-Encoding: chunked
Accept-Ranges: bytes

Domain Information for finnsec.fi

Domain Registrar: Finnish Communications Regulatory Authority finnsec.fi registrar info

Domain Nameserver Information

Host IP Address Country
ns1.mynebula.fi finnsec.fi name server information 217.30.180.225 finnsec.fi server is located in Finland Finland
ns2.mynebula.fi finnsec.fi name server information 217.30.182.225 finnsec.fi server is located in Finland Finland

DNS Record Analysis

Host Type TTL Extra
finnsec.fi A 3600 IP:77.86.189.241
finnsec.fi NS 3600 Target:ns1.mynebula.fi
finnsec.fi NS 3600 Target:ns2.mynebula.fi
finnsec.fi SOA 3600 MNAME:ns1.mynebula.fi
RNAME:hostmaster.mynebula.fi
Serial:992722
Refresh:1800
Retry:600
Expire:86400

Similarly Ranked Websites to Finnsec

Google

finnsec.fi favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View finnsec.fi Pagerank   Alexa rank for finnsec.fi 1   website value of finnsec.fi $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

finnsec.fi favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View finnsec.fi Pagerank   Alexa rank for finnsec.fi 1   website value of finnsec.fi $ 8,833,062,960.00

Gmail

finnsec.fi favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View finnsec.fi Pagerank   Alexa rank for finnsec.fi 1   website value of finnsec.fi $ 8,833,062,960.00

Android Apps on Google Play

finnsec.fi favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View finnsec.fi Pagerank   Alexa rank for finnsec.fi 1   website value of finnsec.fi $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

finnsec.fi favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View finnsec.fi Pagerank   Alexa rank for finnsec.fi 1   website value of finnsec.fi $ 8,833,062,960.00

Full WHOIS Lookup for finnsec.fi

domain.............: finnsec.fi
status.............: Registered
created............: 4.9.2003
expires............: 4.9.2017
available..........: 4.10.2017
modified...........: 11.10.2016
RegistryLock.......: no

Nameservers

nserver............: ns1.mynebula.fi [OK]
nserver............: ns2.mynebula.fi [OK]
dnssec.............: unsigned delegation

Holder

name...............: Suomen Messut Osuuskunta
register number....: 0116322-3
address............: Tietohallinto / Sami Nieminen
address............: Messuaukio 1, PL 21
address............: 00521
address............: Helsinki
country............: Finland
phone..............: +358404503250
holder email.......:

Registrar

registrar..........: Nebula Oy
www................: www.nebula.fi

>>> Last update of WHOIS database: 1.1.2017 11:45:21 (EET)